First detection of bat white-nose syndrome in western North America

First detection of bat white-nose syndrome in western North America

Material Information

First detection of bat white-nose syndrome in western North America
Series Title:
Lorch, Jeffrey M.
Palmer, Jonathan M.
Linder, Daniel L.
Ballmann, Anne E.
George, Kyle G.
Griffin, Kathryn
Knowles, Susan
Huckabee, John R.
Haman, Katherine h.
Anderson, Christopher D.
Becker, Penny A.
Buchanan, Joseph B.
Foster, T. Jeffrey
Blehert, David
American Society for Microbiology Journals
Publication Date:
Physical Description:
1 online resource


Subjects / Keywords:
White-nose syndrome ( lcsh )
Bats -- Motality ( lcsh )
serial ( sobekcm )


White-nose syndrome (WNS) is an emerging fungal disease of bats caused by Pseudogymnoascus destructans. Since it was first detected near Albany, NY, in 2006, the fungus has spread across eastern North America, killing unprecedented numbers of hibernating bats. The devastating impacts of WNS on Nearctic bat species are attributed to the likely introduction of P. destructans from Eurasia to naive host populations in eastern North America. Since 2006, the disease has spread in a gradual wavelike pattern consistent with introduction of the pathogen at a single location. Here, we describe the first detection of P. destructans in western North America in a little brown bat (Myotis lucifugus) from near Seattle, WA, far from the previously recognized geographic distribution of the fungus. Whole-genome sequencing and phylogenetic analyses indicated that the isolate of P. destructans from Washington grouped with other isolates of a presumed clonal lineage from the eastern United States. Thus, the occurrence of P. destructans in Washington does not likely represent a novel introduction of the fungus from Eurasia, and the lack of intensive surveillance in the western United States makes it difficult to interpret whether the occurrence of P. destructans in the Pacific Northwest is disjunct from that in eastern North America. Although there is uncertainty surrounding the impacts of WNS in the Pacific Northwest, the presence of the pathogen in western North America could have major consequences for bat conservation.

Record Information

Source Institution:
University of South Florida Library
Holding Location:
University of South Florida
Rights Management:
All applicable rights reserved by the source institution and holding location.
Resource Identifier:
K26-05066 ( USFLDC DOI )
K26.5066 ( USFLDC handle )

USFLDC Membership

Added automatically
Karst Information Portal

Postcard Information



This item is only available as the following downloads:

Full Text


FirstDetectionofBatWhite-Nose SyndromeinWesternNorthAmericaJeffreyM.Lorch,aJonathanM.Palmer,bDanielL.Lindner,bAnneE.Ballmann,aKyleG.George,aKathrynGrifn,aSusanKnowles,aJohnR.Huckabee,cKatherineH.Haman,dChristopherD.Anderson,dPennyA.Becker,dJosephB.Buchanan,dJeffreyT.Foster,eDavidS.BlehertaU.S.GeologicalSurvey,NationalWildlifeHealthCenter,Madison,Wisconsin,USAa;U.S.ForestService,Northern ResearchStation,CenterforForestMycologyResearch,Madison,Wisconsin,USAb;PAWSWildlifeCenter, Lynnwood,Washington,USAc;WashingtonDepartmentofFishandWildlife,Olympia,Washington,USAd; UniversityofNewHampshire,DepartmentofMolecular,CellularandBiomedicalSciences,Durham,New Hampshire,USAeABSTRACTWhite-nosesyndrome(WNS)isanemergingfungaldiseaseofbats causedby Pseudogymnoascusdestructans .SinceitwasrstdetectednearAlbany, NY,in2006,thefungushasspreadacrosseasternNorthAmerica,killingunprecedentednumbersofhibernatingbats.ThedevastatingimpactsofWNSonNearctic batspeciesareattributedtothelikelyintroductionof P.destructans fromEurasiato naivehostpopulationsineasternNorthAmerica.Since2006,thediseasehasspread inagradualwavelikepatternconsistentwithintroductionofthepathogenatasinglelocation.Here,wedescribetherstdetectionof P.destructans inwesternNorth Americainalittlebrownbat(Myotislucifugus)fromnearSeattle,WA,farfromthe previouslyrecognizedgeographicdistributionofthefungus.Whole-genomesequencingandphylogeneticanalysesindicatedthattheisolateof P.destructans from WashingtongroupedwithotherisolatesofapresumedclonallineagefromtheeasternUnitedStates.Thus,theoccurrenceof P.destructans inWashingtondoesnot likelyrepresentanovelintroductionofthefungusfromEurasia,andthelackofintensivesurveillanceinthewesternUnitedStatesmakesitdifculttointerpret whethertheoccurrenceof P.destructans inthePacicNorthwestisdisjunctfrom thatineasternNorthAmerica.AlthoughthereisuncertaintysurroundingtheimpactsofWNSinthePacicNorthwest,thepresenceofthepathogeninwestern NorthAmericacouldhavemajorconsequencesforbatconservation.IMPORTANCEWhite-nosesyndrome(WNS)representsoneofthemostconsequentialwildlifediseasesofmoderntimes.SinceitwasrstdocumentedinNew Yorkin2006,thediseasehaskilledmillionsofbatsandthreatensseveralformerly abundantspecieswithextirpationorextinction.ThespreadofWNSineasternNorth Americahasbeenrelativelygradual,inducingoptimismthatdiseasemitigationstrategiescouldbeestablishedintimetoconservebatssusceptibletoWNSinwestern NorthAmerica.TherecentdetectionofthefungusthatcausesWNSinthePacic Northwest,farfromitspreviousknowndistribution,increasestheurgencyforunderstandingthelong-termimpactsofthisdiseaseandfordevelopingstrategiestoconserveimperiledbatspecies.KEYWORDS:Pseudogymnoascusdestructans ,Washington,bat,white-nosesyndromeWhite-nosesyndrome(WNS)isacutaneousinfectionofhibernatingbatscausedby thepsychrophilicfungus Pseudogymnoascusdestructans (1,2).Thedisease,rst documentedin2006,wassubsequentlyassociatedwithmassivemortalityofcavehibernatingbatspeciesinthenortheasternUnitedStates(3,4).TheemergenceofWNS islikelyduetotheintroductionof P.destructans intonaivebatpopulationsinNorthReceived 27May2016 Accepted 12July 2016 Published 3August2016 Citation LorchJM,PalmerJM,LindnerDL, BallmannAE,GeorgeKG,GrifnK,KnowlesS, HuckabeeJR,HamanKH,AndersonCD,Becker PA,BuchananJB,FosterJT,BlehertDS.2016. Firstdetectionofbatwhite-nosesyndromein westernNorthAmerica.mSphere1(4):e0014816.doi: 10.1128/mSphere.00148-16. Editor Katherine McMahon,Universityof Wisconsin Copyright 2016Lorchetal.Thisisanopenaccessarticledistributedunderthetermsof the CreativeCommonsAttribution4.0 International license. Address correspondencetoJeffreyM.Lorch, J.M.L.andJ.M.P.contributedequallytothis article.OBSERVATION ClinicalScienceandEpidemiologycrossmark Volume1Issue4e00148-16 1 on April 21, 2017 by guest Downloaded from


America.ThefunguspresumablyoriginatedinEurasia,whereitoccursonbatsbutis notknowntocausesevereinfectionsorpopulationdeclines(5).Consistentwitha pointsourceintroductionofanexoticpathogen, P.destructans hasspreadoutward fromtheWNSepicenterinNewYorkbyapproximately200to900kmperyear(Fig.1). Asofspring2016,thefungushadreachedasfarwestaseasternOklahoma,eastern Nebraska,andeasternMinnesota,approximately1,900kmfromthepresumedsiteof introduction. On11March2016,amoribundlittlebrownbat(Myotislucifugus)wasfoundinKing County,WA(UnitedStates),andsubmittedtoalocalwildliferehabilitationcenter.The animalpresentedwithdriedandcontractedareasofcrustedskinonthewingsanddied 2dayslater.Swabsamplesofthewingswerepositivefor P.destructans byreal-timePCR (8),andthebatwasconrmedtohaveWNSinaccordancewithdenedhistopathologic criteria(9).Anisolateof P.destructans wasobtainedbyculturingaportionofwingskin onSabourauddextroseagarcontainingchloramphenicolandgentamicinat13C. IneasternNorthAmerica, P.destructans appearstobespreadingclonally,withall isolatesexhibitingnogeneticdiversityatthemarkersexamined(10).However,isolates ofthefungusfromEuropedisplaysignicantgeneticvariation(11).Todetermine whethertheisolateof P.destructans fromWashingtonmatchedtheclonallineagefrom easternNorthAmerica,weconductedwhole-genomesequencingusingtheIonTorrent PersonalGenomeMachine(PGM)ontheWashingtonisolate(NWHC#27099-001),as wellasonthreeadditionalisolatesof P.destructans fromeasternNorthAmerica.These isolatesoriginatedfrom M.lucifugus batscollectedinAlbanyCounty,NY,in2008 (NWHC#20631-008)andinIowaCounty,WI,in2016(NWHC#26994-002)andatricoloredbat(Perimyotissubavus)inJacksonCounty,AL,in2015(NWHC#44797-145). ForcomparisontoEuropeanisolatesof P.destructans,weusedwhole-genomedata fromisolatesfromtheCzechRepublic(isolatesCCF3941,CCF3942,CCF4124,and CCF4125)availableintheNCBISRADatabase(accessionnumbers SRR3411506, SRR3411507, SRR3411508,and SRR3411509),aswellastheNorthAmericantypeisolate (NWHC#20631-21; NCBISRAaccessionnumber SRR1952982). Sequencing followedthemanufacturers(ThermoFisherScientic)recommendationsusingthefollowingkits:Ionplusfragmentlibrarykit(catalognumber4471252), FIG1Generalizedspatiotemporalspreadof Pseudogymnoascusdestructans acrossNorthAmerica sincetheinitialdetectionofwhite-nosesyndrome(WNS)inNewYorkin2006.Themapwas generatedusingthenatural-neighborrasterinterpolationtoolinArcMap10.2.1(ESRI,Redlands,CA), basedonfirstdetectionof P.destructans withinacountyorfirstclassificationofacountyassuspect forWNS.ThemapwasgeneratedusingdatafromtheU.S.GeologicalSurvey,NationalWildlifeHealth Center,and of thepathogenduringagivenwinter(hibernation)seasonspanningfromNovembertoMay.Lorchetal. Volume1Issue4e00148-16 2 on April 21, 2017 by guest Downloaded from


IonlibraryTaqManquantitationkit(catalognumber4468802),IonPGMHi-QviewOT2 (OneTouch2)kit(catalognumberA29811),Ion318v2(catalognumber4484354),and IonPGMHi-Qviewsequencingkit(catalognumberA30043).Therawsequencingdata wereprocessedusingthedefaultsettingsintheTorrentSuitesoftwareversion5.0.4. Foreachisolate,weobtainedmorethan12 averagedepthofsequencingcoverage overthe P.destructans genomereference.Single-nucleotidepolymorphisms(SNPs) wereidentiedfromthenext-generationsequencingreadsusingtheSnippypipeline version3.0(12).Briey,readswerealignedtothe P.destructans typeisolate (NWHC#20631-021)referencegenome(13)(GenBankaccessionnumberGCA_ 001641265.1)usingBurrows-WheelerAligner(BWA)version0.7.12-r1044(14),and variantswerecalledusingFreeBayesversion0.9.21-7-g7dd41db(15)withaminimum readcoverageof4(foreachisolate,thegenomecoveragewasatleast98.27%ata4 threshold),minimummappingqualitysetto60,andminimumproportionforvariant evidencesetto90%.AconcatenatedalignmentofcoreSNPs(denedasanSNPthat occursatagenomicpositionpresentinallsamples)wasgeneratedusingSnippy,and anunrootedphylogenictreewasinferredfromtheresulting13,379charactersusing theneighbor-joiningmethodandtheJukes-CantorsubstitutionmodelinCLCGenomicsWorkbench9.Asasecondarymethod,maximum-likelihoodanalysiswasperformed usingthegeneraltime-reversible(GTR)substitutionmodelinMEGAversion6.06. Thegenomesequenceoftheisolateof P.destructans fromWashingtonwasstatisticallyindistinguishablefromthefourNorthAmericanisolates,formingacladedistinct fromthefourEuropeanisolates(Fig.2).Althoughtheywerecollectedfromamore connedgeographicregion(twohibernaculaintheCzechRepublic),theEuropean isolatesexhibitedmuchhighergeneticdiversitythantheNorthAmericanisolatesand includedbothknownmatingtypes;onlythe MAT1-1 matingtypehasthusfarbeen identiedamongisolatesfromNorthAmerica(Fig.2)(16).Theminimaldiversityand singlematingtypeobservedamongisolatesof P.destructans fromtheNearcticis consistentwithclonalspreadofthepathogeninNorthAmerica.Theseobservations alsosuggestthattheWashingtonisolateof P.destructans islikelyofNorthAmerican originratherthanrepresentinganindependentintroductioneventfromEurasia. Thetimingandmechanismbywhich P.destructans mayhavereachedthePacic Northwestareunclear.Thenearestdetectionof P.destructans isover2,100kmawayin easternNebraska.Inthedecadesince P.destructans wasrstdetectedinNorth America,thefungushasspreadapproximately1,900kmfromthesuspectedintroducFIG2 Phylogeneticrelationshipsbasedonwhole-genomesequenceanalysisofnineisolatesof Pseudogymnoascus destructans fromNorthAmericaandEurope.Acorealignmentof13,379SNPswasgeneratedforeachisolate,usingSnippy (11),andphylogenywasinferredbydrawinganunrootedneighbor-joiningtreesupportedwith1,000bootstrapreplicates (branchlengthsrepresentthenumberofsubstitutionspersite).Asecondanalysisusingmaximumlikelihoodproduced atreewithidenticaltopology.Thusfar,isolatesof P.destructans fromNorthAmericaappeartobeclonal,whereasthere isconsiderablevariationinpopulationsof P.destructans inEurope(eveninthissmallsamplesizeofisolatesfromalimited geographicalrange).Isolatesfrombothmatingtypes(MAT1-1 and MAT1-2)arefoundinEurope,suggestingthatsexually recombiningpopulationscontributetotheincreaseingenomicvariability.Asinglematingtype( MAT1-1)isknownfrom NorthAmerica.Bootstrapvalues(neighbor-joininganalysis/maximum-likelihoodanalysis)forwell-supportednodes(>90) arepresented.White-NoseSyndromeinWashington Volume1Issue4e00148-16 3 on April 21, 2017 by guest Downloaded from


tionsite.Thus,therecentdetectioninWashingtonappearsinconsistentwiththe previouslydocumentedandpredictedpatternofpathogenspread(17).Sequence analysisoftheWashingtonbatsmitochondrialNADHdehydrogenasesubunit1,cytochrome b (cytb),andcytochrome c oxidasesubunitI(COI)genes(18,19)mostclosely matchedGenBanksequencesforlittlebrownbatsfromwesternNorthAmerica.Phylogeneticanalysesperformedonthecyt b andCOIgenesfurtherdemonstratedthatthe infectedbatfromWashingtonresidedwithinawell-supportedclade(bootstrapsupport valuesof100and95forthecytb geneandtheCOIgene,respectively;seeFig.S1inthe supplementalmaterial)thatincludedmembersof M.lucifugus alascensis,asubspecies restrictedindistributiontowesternNorthAmerica.Thisndingsuggeststhatthe animalbecameinfectedwith P.destructans inthePacicNorthwestandthatthebat wasnotavagrantfromeasternNorthAmerica,whereWNSisnowendemic.Sampling ofbatsandcaveenvironmentsinthewesternUnitedStatessincethewinterof 2013-2014withoutdetectionofthefungussuggeststhatthepathogenisnotwidespreadorabundantinthisenvironmentinwesternstates(i.e.,over2,000samples testedfromArizona,California,Colorado,Idaho,Montana,Nebraska,NewMexico, Nevada,Oklahoma,Oregon,Texas,Utah,Washington,andWyoming;A.Ballmann, unpublisheddata).Moreintensivesurveillanceeffortstodenetherangeof P.destructans inwesternNorthAmericashouldimproveourunderstandingofthepresence, distribution,andoriginofthispathogeninthePacicNorthwest. Thepresenceof P.destructans inwesternNorthAmericahasmajorimplicationsfor conservationofbatpopulations.Theadditionofapotentialseconddiseaseepicenter couldexposenovelhostspeciestothepathogen,acceleratetherateatwhichWNS spreads,andreducetheamountoftimethatwildlifemanagementagencieshaveto developmitigationstrategies.RapidresponsestoWNSinwesternNorthAmericamay bedifcult,becausethelocationsofhibernationsitesformanywesternbatspeciesare unknownorinaccessible(20,21).Furthermore,thewinteringstrategiesofmanyspecies ofbatsinthePacicNorthwestarenotwellunderstood,withsomespeciesknownto foragethroughoutthewinter(22).Consequently,newapproachesmaybenecessaryto facilitatepathogensurveillance,monitordiseaseimpacts,andconductmitigation effortsforWNSinthisregion.Theseverity,magnitude,duration,andpotential ecosystem-leveleffectsofWNSinNorthAmericarankitamongthemostconsequential wildlifediseaseeventseverrecorded.Althoughmuchprogresshasbeenmadein understandingWNSandinmonitoringitsspread,moreworkisneededtodetermine howthediseasedynamicsandimpactsvaryamongbatpopulationsineasternand westernNorthAmerica.Accessionnumbers. NucleicacidsequencesfortheNADHdehydrogenasesubunit1, cytochrome b,andcytochrome c oxidasesubunitIgenesofthelittlebrownbatwith WNSfromWashingtonareavailableinGenBank(accessionnumbers KX290926, KX290927,and KX463942,respectively).Next-generationsequencingdataareavailable through theNCBISRAdatabase(accessionnumber SRP075419)andtheBioProject database (accessionnumber PRJNA322173).SUPPLEMENTALMATERIAL Supplementalmaterialforthisarticlemaybefoundat mSphere.00148-16. Figure S1,PDFle,0.3MB. ACKNOWLEDGMENTS WethankBrendaBerlowski-Zier,ElizabethBohuski,StephanieSteinfeldt,andKaren Vanderwolf forassistanceinpreparingsamplesandconductinglaboratorytests. Wedeclarenoconictofinterestrelatedtothiswork. Theuseoftrade,rm,orproductnamesisfordescriptivepurposesonlyanddoes notimplyendorsementbytheU.S.Government. ThisworkwasfundedbytheU.S.GeologicalSurveyandU.S.ForestService.Lorchetal. Volume1Issue4e00148-16 4 on April 21, 2017 by guest Downloaded from


FUNDINGINFORMATION Thiswork,includingtheeffortsofJeffreyM.Lorch,wasfundedbyDOI|U.S.Geological Survey (USGS).Thiswork,includingtheeffortsofDanielL.Lindner,wasfundedby USDA|U.S.ForestService(USFS). REFERENCES1. GargasA,TrestMT,ChristensenM,VolkTJ,BlehertDS.2009. Geomycesdestructans sp.nov.associatedwithbatwhite-nosesyndrome. Mycotaxon 108:147. 2. Lorch JM,MeteyerCU,BehrMJ,BoylesJG,CryanPM,HicksAC, BallmannAE,ColemanJT,RedellDN,ReederDM,BlehertDS.2011. Experimentalinfectionofbatswith Geomycesdestructans causeswhitenosesyndrome.Nature 480:376. nature10590. 3. Blehert DS,HicksAC,BehrM,MeteyerCU,Berlowski-ZierBM, BucklesEL,ColemanJT,DarlingSR,GargasA,NiverR,Okoniewski JC,RuddRJ,StoneWB.2009.Batwhite-nosesyndrome:anemerging fungalpathogen?Science 323:227. science.1163874. 4. Turner GG,ReederDM,ColemanJTH.2011.Ave-yearassessmentof mortalityandgeographicspreadofwhite-nosesyndromeinNorth Americanbatsandalooktothefuture.BatResNews 52:13. 5. PuechmailleSJ,WibbeltG,KornV,FullerH,ForgetF,MhldorferK, KurthA,BogdanowiczW,BorelC,BoschT,CherezyT,DrebetM, GrflT,HaarsmaAJ,HerhausF,HallartG,HammerM,Jungmann C,LeBrisY,LutsarL,MasingM,MulkensB,PassiorK,StarrachM, WojtaszewskiA,ZphelU,TeelingEC.2011.Pan-Europeandistributionofwhite-nosesyndromefungus(Geomycesdestructans)notassociatedwithmassmortality.PLoSOne 6:e19167. journal.pone.0019167. 6. Hoyt JR,LangwigKE,SunK,LuG,PariseKL,JiangT,FrickWF, FosterJT,FengJ,KilpatrickAM.2016.Hostpersistenceorextinction fromemerginginfectiousdisease:insightsfromwhite-nosesyndromein endemicandinvadingregions.ProcRSocB 283:20152861. http:// 7. Zukal J,BandouchovaH,BrichtaJ,CmokovaA,JaronKS,KolarikM, KovacovaV,KubtovA,NovkovA,OrlovO,PikulaJ,Presetnik P,ubaJ,ZahradnkovA,Jr,MartnkovN.2016.White-nosesyndromewithoutborders: Pseudogymnoascusdestructans infectiontoleratedinEuropeandPalearcticAsiabutnotinNorthAmerica.SciRep 6:19829. 8. Muller LK,LorchJM,LindnerDL,OConnorM,GargasA,BlehertDS. 2013.Batwhite-nosesyndrome:areal-timeTaqManpolymerasechain reactiontesttargetingtheintergenicspacerregionof Geomycesdestructans.Mycologia 105:253. 9. Meteyer CU,BucklesEL,BlehertDS,HicksAC,GreenDE,ShearnBochslerV,ThomasNJ,GargasA,BehrMJ.2009.Histopathologic criteriatoconrmwhite-nosesyndromeinbats.JVetDiagnInvest 21:411414. 10. Ren P,HamanKH,LastLA,RajkumarSS,KeelMK,ChaturvediV. 2012.Clonalspreadof Geomycesdestructans amongbats,midwestern andsouthernUnitedStates.EmergInfectDis 18:883885. http:// 11. Leopardi S,BlakeD,PuechmailleSJ.2015.White-nosesyndrome fungusintroducedfromEuropetoNorthAmerica.CurrBiol 25: R217R219. 12. Seemann T.2015.Snippy:fastbacterialvariantcallingfromNGSreads. 13. Drees KP,PalmerJM,SebraR,LorchJM,ChenC,WuCC,BokJW, KellerNP,BlehertDS,CuomoCA,LindnerDL,FosterJT.2016.Useof multiplesequencingtechnologiestoproduceahighqualitygenomeof thefungus Pseudogymnoascusdestructans,thecausativeagentofbat white-nosesyndrome.GenomeAnnounc 4:e00445-16. 10.1128/genomeA.00445-16 14. Li H.2013.Aligningsequencereads,clonesequencesandassembly contigswithBWA-MEM.arXivarXiv:1303.3997[q-bio.GN]. https:// 15. Garrison E,MarthG.2012.Haplotype-basedvariantdetectionfrom short-readsequencing.arXivarXiv:1207.3907[q-bio.GN]. https:// 16. Palmer JM,KubatovaA,NovakovaA,MinnisAM,KolarikM,Lindner DL.2014.Molecularcharacterizationofaheterothallicmatingsystemin Pseudogymnoascusdestructans,thefunguscausingwhite-nosesyndromeofbats.G3(Bethesda) 4:1755. g3.114.012641 17. Maher SP,KramerAM,PulliamJT,ZokanMA,BowdenSE,Barton HD,MagoriK,DrakeJM.2012.Spreadofwhite-nosesyndromeona networkregulatedbygeographyandclimate.NatCommun 3:1306. 18. Ruedi M,MayerF.2001.Molecularsystematicsofbatsofthegenus Myotis (Vespertilionidae)suggestsdeterministicecomorphologicalconvergences.MolPhylogenetEvol 21:436448. mpev.2001.1017. 19. Vonhof MJ,RussellAL,Miller-ButterworthCM.2015.Range-wide geneticanalysisoflittlebrownbat(Myotislucifugus)populations:estimatingtheriskofspreadofwhite-nosesyndrome.PLoSOne 10: e0128713. 20. Perkins JM,BarssJM,PetersonJ.1990.Winterrecordsofbatsin OregonandWashington.NorthwestNat 71:5962. 10.2307/3536594. 21. Bogan MA,CryanPM,ValdezEW,EllisonLE,OSheaTJ.2003.Westerncreviceandcavity-roostingbats,p69. In OSheaTJ,BoganMA (ed),MonitoringtrendsinbatpopulationsoftheUnitedStatesand territories:problemsandprospects.Informationandtechnologyreport 2003-0003.U.S.GeologicalSurvey,FortCollins,CO. 22. FalxaG.2007.Winterforagingofsilver-hairedandCaliforniamyotisbats inwesternWashington.NorthwestNat 88:98. 10.1898/1051-1733(2007)88[98:WFOSAC]2.0.CO;2. 23. Stamatakis A.2014.RAxMLversion8:atoolforphylogeneticanalysis andpost-analysisoflargephylogenies.Bioinformatics 30:1312. 24. Miller MA,PfeifferW,SchwartzT.2010.CreatingtheCIPRESScience Gatewayforinferenceoflargephylogenetictrees,p18. In Proceedings oftheGatewayComputingEnvironmentsWorkshop(GCE),14November2010,NewOrleans,LA. Volume1Issue4e00148-16 5 on April 21, 2017 by guest Downloaded from


Download Options

No images are available for this item.
Cite this item close


Cras ut cursus ante, a fringilla nunc. Mauris lorem nunc, cursus sit amet enim ac, vehicula vestibulum mi. Mauris viverra nisl vel enim faucibus porta. Praesent sit amet ornare diam, non finibus nulla.


Cras efficitur magna et sapien varius, luctus ullamcorper dolor convallis. Orci varius natoque penatibus et magnis dis parturient montes, nascetur ridiculus mus. Fusce sit amet justo ut erat laoreet congue sed a ante.


Phasellus ornare in augue eu imperdiet. Donec malesuada sapien ante, at vehicula orci tempor molestie. Proin vitae urna elit. Pellentesque vitae nisi et diam euismod malesuada aliquet non erat.


Nunc fringilla dolor ut dictum placerat. Proin ac neque rutrum, consectetur ligula id, laoreet ligula. Nulla lorem massa, consectetur vitae consequat in, lobortis at dolor. Nunc sed leo odio.